PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC007507.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 330aa    MW: 36525.5 Da    PI: 6.7317
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC007507.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-32129182255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EcC007507.10 129 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 182
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-15126183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28127183IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23129182IPR006447Myb domain, plants
PfamPF002492.1E-7130181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MTPSPTFPDL SLQINPPGVP DSGKKVAIYD CDDFARKPFC SEMSSTTDSA SSGSDLSHEN  60
NFLSQERSFS HGHGEPTLSL GFAMGDVNHS TLQQPPRNLN HHHHPHLYSR EFKRSTRVGS  120
SVKRSIRAPR MRWTTTLHAH FVHAVQLLGG HERATPKSVL ELMNVKDLTL AHVKSHLQMY  180
RTVKSTDKGS SGQVQTLDVG TKHVEAGSLS SEKHEDCDNS YSLNPSSQAS FKQTQGGLLW  240
LQSMETSGTS ESDHENALTY DSHFKANDAK VDGQKIIDRR MSEDAKERLD SSSLSPPPED  300
ALVNLEFTLG RPSWQMDCTE SSPELTLLKC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061802.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A059BRR30.0A0A059BRR3_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g11390.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.19e-62G2-like family protein